PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_35207_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family M-type_MADS
Protein Properties Length: 246aa    MW: 27429.7 Da    PI: 10.4069
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_35207_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF565.1e-181150342
                    --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
          SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                    i ++s r+ tf kR++g++KK +ELS+LC++ev+ iifs+
  Neem_35207_f_1 11 IPSDSARKATFKKRKKGLMKKVSELSILCGIEVCAIIFSP 50
                    77999*********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.5E-25160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006618.278149IPR002100Transcription factor, MADS-box
CDDcd002662.36E-20285No hitNo description
SuperFamilySSF554552.22E-24294IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-10323IPR002100Transcription factor, MADS-box
PfamPF003191.5E-181150IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-102338IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-103859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MTRKKVKLAY IPSDSARKAT FKKRKKGLMK KVSELSILCG IEVCAIIFSP FDAEPEIWPS  60
PMGIRHMLSQ FKNMPKMEQS KKMVNQDSFL KQSIARANEQ LKRQRKDNRE KEITKVMFKG  120
LTVGKLLQQG LNMLDLNDLG CIVEQNLKEI SKRMEVLNKG GSNSSSGATT VHSSSQGKAP  180
VAASASQGEK KSPGFDQKQP QWFVDLMNPK ENNMGGFGGE EVIVFPFGDG DGATHTKNLW  240
SNPFYP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1224RKKVKLAYIPSDSARKATFKKRK
22125KKRKK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006493926.12e-99PREDICTED: agamous-like MADS-box protein AGL80
SwissprotQ9FJK36e-63AGL80_ARATH; Agamous-like MADS-box protein AGL80
TrEMBLV4SWL01e-98V4SWL0_9R
STRINGVIT_14s0060g00300.t014e-82(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.15e-62AGAMOUS-like 80